Lineage for d1kcka2 (1kck A:582-686)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106204Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 106205Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 106206Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 106216Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 106217Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)
  8. 106226Domain d1kcka2: 1kck A:582-686 [68442]
    Other proteins in same PDB: d1kcka1, d1kcka3, d1kcka4

Details for d1kcka2

PDB Entry: 1kck (more details), 2.43 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant n193g

SCOP Domain Sequences for d1kcka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcka2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d1kcka2:

Click to download the PDB-style file with coordinates for d1kcka2.
(The format of our PDB-style files is described here.)

Timeline for d1kcka2: