Lineage for d1kcgc_ (1kcg C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190306Protein Class I MHC-related molecule Ulbp3 [69681] (1 species)
  7. 190307Species Human (Homo sapiens) [TaxId:9606] [69682] (1 PDB entry)
  8. 190308Domain d1kcgc_: 1kcg C: [68440]
    Other proteins in same PDB: d1kcga_, d1kcgb_

Details for d1kcgc_

PDB Entry: 1kcg (more details), 2.6 Å

PDB Description: NKG2D in complex with ULBP3
PDB Compounds: (C:)

SCOP Domain Sequences for d1kcgc_:

Sequence, based on SEQRES records: (download)

>d1kcgc_ d.19.1.1 (C:) Class I MHC-related molecule Ulbp3 {Human (Homo sapiens)}
dahslwynftiihlprhgqqwcevqsqvdqknflsydcgsdkvlsmghleeqlyatdawg
kqlemlrevgqrlrleladteledftpsgpltlqvrmsceceadgyirgswqfsfdgrkf
llfdsnnrkwtvvhagarrmkekwekdsglttffkmvsmrdckswlrdflmhrkkrle

Sequence, based on observed residues (ATOM records): (download)

>d1kcgc_ d.19.1.1 (C:) Class I MHC-related molecule Ulbp3 {Human (Homo sapiens)}
dahslwynftiihlprhgqqwcevqsqvdqknflsydcgsdkvlsmghleeqlyatdawg
kqlemlrevgqrlrleladtepltlqvrmsceceadgyirgswqfsfdgrkfllfdsnnr
kwtvvhagarrmkekwekdsglttffkmvsmrdckswlrdflmhrkkrle

SCOP Domain Coordinates for d1kcgc_:

Click to download the PDB-style file with coordinates for d1kcgc_.
(The format of our PDB-style files is described here.)

Timeline for d1kcgc_: