Lineage for d1kcag_ (1kca G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818820Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 2818821Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 2818822Family b.87.1.1: LexA-related [51307] (4 proteins)
  6. 2818823Protein lambda repressor C-terminal domain [51310] (1 species)
  7. 2818824Species Bacteriophage lambda [TaxId:10710] [51311] (2 PDB entries)
  8. 2818833Domain d1kcag_: 1kca G: [68432]

Details for d1kcag_

PDB Entry: 1kca (more details), 2.91 Å

PDB Description: Crystal Structure of the lambda Repressor C-terminal Domain Octamer
PDB Compounds: (G:) repressor protein ci

SCOPe Domain Sequences for d1kcag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcag_ b.87.1.1 (G:) lambda repressor C-terminal domain {Bacteriophage lambda [TaxId: 10710]}
asdsafwlevegnsmtaptgskpsfpdgmlilvdpeqavepgdfciarlggdeftfkkli
rdsgqvflqplnpqypmipcnescsvvgkviasqwpeetfg

SCOPe Domain Coordinates for d1kcag_:

Click to download the PDB-style file with coordinates for d1kcag_.
(The format of our PDB-style files is described here.)

Timeline for d1kcag_: