Lineage for d1kbwd2 (1kbw D:164-314)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553929Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 554017Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 554219Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)
  8. 554239Domain d1kbwd2: 1kbw D:164-314 [68414]

Details for d1kbwd2

PDB Entry: 1kbw (more details), 2.4 Å

PDB Description: crystal structure of the soluble domain of ania from neisseria gonorrhoeae

SCOP Domain Sequences for d1kbwd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbwd2 b.6.1.3 (D:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim

SCOP Domain Coordinates for d1kbwd2:

Click to download the PDB-style file with coordinates for d1kbwd2.
(The format of our PDB-style files is described here.)

Timeline for d1kbwd2: