SCOP 1.71: Domain d1kbvf2: 1kbv F:164-314

Lineage for d1kbvf2 (1kbv F:164-314)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)

8. Domain d1kbvf2: 1kbv F:164-314 [68406]
   complexed with cu, no2

Details for d1kbvf2

PDB Entry: 1kbv, 1.95 Å

PDB Description: nitrite-soaked crystal structure of the soluble domain of ania from neisseria gonorrhoeae

SCOP Domain Sequences for d1kbvf2:

Sequence; same for both SEQRES and ATOM records:

>d1kbvf2 b.6.1.3 (F:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim

Timeline for d1kbvf2:

• d1kbvf2 first appeared in SCOP 1.59
  
• d1kbvf2 appears in SCOP 1.69
  
• d1kbvf2 appears in SCOP 1.73
  
• d1kbvf2 appears in the current release, SCOPe 2.08