Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries) |
Domain d1kbve1: 1kbv E:13-163 [68403] complexed with cu, no2 |
PDB Entry: 1kbv (more details), 1.95 Å
SCOPe Domain Sequences for d1kbve1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbve1 b.6.1.3 (E:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi yhcavapvgmhiangmyglilvepkeglpkv
Timeline for d1kbve1: