Lineage for d1kbve1 (1kbv E:13-163)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303271Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1303430Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 1303774Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)
  8. 1303783Domain d1kbve1: 1kbv E:13-163 [68403]
    complexed with cu, no2

Details for d1kbve1

PDB Entry: 1kbv (more details), 1.95 Å

PDB Description: nitrite-soaked crystal structure of the soluble domain of ania from neisseria gonorrhoeae
PDB Compounds: (E:) Major outer membrane protein PAN 1

SCOPe Domain Sequences for d1kbve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbve1 b.6.1.3 (E:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv

SCOPe Domain Coordinates for d1kbve1:

Click to download the PDB-style file with coordinates for d1kbve1.
(The format of our PDB-style files is described here.)

Timeline for d1kbve1: