Lineage for d1kbvc2 (1kbv C:164-314)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106913Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 106961Protein Nitrite reductase, NIR [49551] (4 species)
  7. 107075Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)
  8. 107081Domain d1kbvc2: 1kbv C:164-314 [68400]

Details for d1kbvc2

PDB Entry: 1kbv (more details), 1.95 Å

PDB Description: nitrite-soaked crystal structure of the soluble domain of ania from neisseria gonorrhoeae

SCOP Domain Sequences for d1kbvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbvc2 b.6.1.3 (C:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim

SCOP Domain Coordinates for d1kbvc2:

Click to download the PDB-style file with coordinates for d1kbvc2.
(The format of our PDB-style files is described here.)

Timeline for d1kbvc2: