Lineage for d1kbla1 (1kbl A:510-873)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573147Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 573238Family c.1.12.2: Pyruvate phosphate dikinase, C-terminal domain [51629] (1 protein)
  6. 573239Protein Pyruvate phosphate dikinase, C-terminal domain [51630] (2 species)
  7. 573240Species Clostridium symbiosum [TaxId:1512] [51631] (6 PDB entries)
  8. 573241Domain d1kbla1: 1kbl A:510-873 [68384]
    Other proteins in same PDB: d1kbla2, d1kbla3
    complexed with nh4, so4

Details for d1kbla1

PDB Entry: 1kbl (more details), 1.94 Å

PDB Description: pyruvate phosphate dikinase

SCOP Domain Sequences for d1kbla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbla1 c.1.12.2 (A:510-873) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum}
ietqeasvsgsferimvwadkfrtlkvrtnadtpedtlnavklgaegiglcrtehmffea
drimkirkmilsdsveareealnelipfqkgdfkamykalegrpmtvryldpplhefvph
teeeqaelaknmgltlaevkakvdelhefnpmmghrgcrlavtypeiakmqtravmeaai
evkeetgidivpeimiplvgekkelkfvkdvvvevaeqvkkekgsdmqyhigtmieipra
altadaiaeeaeffsfgtndltqmtfgfsrddagkfldsyykakiyesdpfarldqtgvg
qlvemavkkgrqtrpglkcgicgehggdpssvefchkvglnyvscspfrvpiarlaaaqa
alnn

SCOP Domain Coordinates for d1kbla1:

Click to download the PDB-style file with coordinates for d1kbla1.
(The format of our PDB-style files is described here.)

Timeline for d1kbla1: