Lineage for d1kb0a2 (1kb0 A:1-573)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114357Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 114358Superfamily b.70.1: Quinoprotein alcohol dehydrogenase [50998] (1 family) (S)
  5. 114359Family b.70.1.1: Quinoprotein alcohol dehydrogenase [50999] (3 proteins)
  6. 114377Protein Quinoprotein alcohol dehydrogenase, N-terminal domain [69326] (1 species)
  7. 114378Species Comamonas testosteroni [TaxId:285] [69327] (1 PDB entry)
  8. 114379Domain d1kb0a2: 1kb0 A:1-573 [68379]
    Other proteins in same PDB: d1kb0a1

Details for d1kb0a2

PDB Entry: 1kb0 (more details), 1.44 Å

PDB Description: Crystal Structure of Quinohemoprotein Alcohol Dehydrogenase from Comamonas testosteroni

SCOP Domain Sequences for d1kb0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni}
tgpaaqaaaavqrvdgdfiranaartpdwptigvdyaetrysrldqinaanvkdlglaws
ynlestrgveatpvvvdgimyvsaswsvvhaidtrtgnriwtydpqidrstgfkgccdvv
nrgvalwkgkvyvgawdgrlialdaatgkevwhqntfegqkgsltitgaprvfkgkviig
nggaeygvrgyitaydaetgerkwrwfsvpgdpskpfedesmkraartwdpsgkwweagg
ggtmwdsmtfdaelntmyvgtgngspwshkvrspkggdnlylasivaldpdtgkykwhyq
etpgdnwdytstqpmiladikiagkprkvilhapkngfffvldrtngkfisaknfvpvnw
asgydkhgkpigiaaardgskpqdavpgpygahnwhpmsfnpqtglvylpaqnvpvnlmd
dkkwefnqagpgkpqsgtgwntakffnaeppkskpfgrllawdpvaqkaawsvehvspwn
ggtlttagnvvfqgtadgrlvayhaatgeklweaptgtgvvaapstymvdgrqyvsvavg
wggvyglaaraterqgpgtvytfvvggkarmpe

SCOP Domain Coordinates for d1kb0a2:

Click to download the PDB-style file with coordinates for d1kb0a2.
(The format of our PDB-style files is described here.)

Timeline for d1kb0a2:

Domains from same chain:
(mouse over for more information)
d1kb0a1