Lineage for d1ka6a_ (1ka6 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332255Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 332256Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 332257Family d.93.1.1: SH2 domain [55551] (25 proteins)
  6. 332451Protein The Xlp protein Sap [55591] (1 species)
  7. 332452Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries)
  8. 332461Domain d1ka6a_: 1ka6 A: [68370]
    complexed with nh2; mutant

Details for d1ka6a_

PDB Entry: 1ka6 (more details)

PDB Description: sap/sh2d1a bound to peptide n-py

SCOP Domain Sequences for d1ka6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka6a_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens)}
mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvekkss

SCOP Domain Coordinates for d1ka6a_:

Click to download the PDB-style file with coordinates for d1ka6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ka6a_: