Lineage for d1ka6a_ (1ka6 A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein The Xlp protein Sap [55591] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55592] (5 PDB entries) 
Domain d1ka6a_: 1ka6 A: [68370]
Details for d1ka6a_
PDB Entry: 1ka6 (more details)
PDB Description: sap/sh2d1a bound to peptide n-py
SCOP Domain Sequences for d1ka6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ka6a_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens)}
mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvekkss
SCOP Domain Coordinates for d1ka6a_:
Click to download the PDB-style file with coordinates for d1ka6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ka6a_:
- d1ka6a_ first appeared in SCOP 1.59
- d1ka6a_ appears in SCOP 1.63
- d1ka6a_ appears in the current release, SCOPe 2.08
View in 3D