Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (8 families) |
Family d.169.1.1: C-type lectin domain [56437] (28 proteins) Pfam PF00059 |
Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69858] (4 PDB entries) Uniprot Q9NNX6 219-397 |
Domain d1k9jb_: 1k9j B: [68354] complexed with ca, man, nag |
PDB Entry: 1k9j (more details), 1.9 Å
SCOP Domain Sequences for d1k9jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9jb_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} hcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfs wmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdny wickkpaa
Timeline for d1k9jb_: