Lineage for d1k9jb_ (1k9j B:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (17 proteins) 
Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69858] (1 PDB entry) 
Domain d1k9jb_: 1k9j B: [68354]
Details for d1k9jb_
PDB Entry: 1k9j (more details), 1.9 Å
PDB Description: complex of dc-signr and glcnac2man3
SCOP Domain Sequences for d1k9jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9jb_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)}
hcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfs
wmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdny
wickkpaa
SCOP Domain Coordinates for d1k9jb_:
Click to download the PDB-style file with coordinates for d1k9jb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k9jb_:
- d1k9jb_ is new in SCOP 1.59
- d1k9jb_ appears in SCOP 1.61
- d1k9jb_ appears in the current release, SCOPe 2.08
View in 3D
