Lineage for d1k94b_ (1k94 B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97667Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 97708Protein Grancalcin [47550] (1 species)
  7. 97709Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)
  8. 97711Domain d1k94b_: 1k94 B: [68334]

Details for d1k94b_

PDB Entry: 1k94 (more details), 1.7 Å

PDB Description: Crystal structure of des(1-52)grancalcin with bound calcium

SCOP Domain Sequences for d1k94b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k94b_ a.39.1.7 (B:) Grancalcin {Human (Homo sapiens)}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai

SCOP Domain Coordinates for d1k94b_:

Click to download the PDB-style file with coordinates for d1k94b_.
(The format of our PDB-style files is described here.)

Timeline for d1k94b_: