SCOPe 2.08: Domain d1k94b_: 1k94 B:

Lineage for d1k94b_ (1k94 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Grancalcin [47550] (1 species)
   Calpain small subunit homologue

7. Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)

8. Domain d1k94b_: 1k94 B: [68334]
   complexed with ca

Details for d1k94b_

PDB Entry: 1k94, 1.7 Å

PDB Description: Crystal structure of des(1-52)grancalcin with bound calcium

PDB Compounds: (B:) grancalcin

SCOPe Domain Sequences for d1k94b_:

Sequence; same for both SEQRES and ATOM records:

>d1k94b_ a.39.1.8 (B:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai

Timeline for d1k94b_:

• d1k94b_ first appeared in SCOP 1.59
  
• d1k94b_ appears in SCOPe 2.07