Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (12 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (81 PDB entries) Uniprot P02593 |
Domain d1k90f_: 1k90 F: [68324] Other proteins in same PDB: d1k90a_, d1k90b_, d1k90c_ complexed with 3at, ca, yb |
PDB Entry: 1k90 (more details), 2.75 Å
SCOPe Domain Sequences for d1k90f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k90f_ a.39.1.5 (F:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem ireadidgdgqvnyeefvqmmta
Timeline for d1k90f_: