Lineage for d1k90c_ (1k90 C:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1236110Fold e.41: Adenylylcyclase toxin (the edema factor) [81299] (1 superfamily)
    3 domains: (1&2) alpha+beta, with domain 2 being inserted in domain 1; (3) all-alpha
  4. 1236111Superfamily e.41.1: Adenylylcyclase toxin (the edema factor) [81298] (1 family) (S)
    Domain 1 has topological and active site similarity to the Nucleotidyltransferases (eg. 1kny N-domain); domain 3 binds calmodulin
  5. 1236112Family e.41.1.1: Adenylylcyclase toxin (the edema factor) [69887] (1 protein)
    decorated with many insertions and the C-terminal domain
  6. 1236113Protein Adenylylcyclase toxin (the edema factor) [69888] (1 species)
  7. 1236114Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69889] (7 PDB entries)
    Uniprot P40136
  8. 1236118Domain d1k90c_: 1k90 C: [68321]
    Other proteins in same PDB: d1k90d_, d1k90e_, d1k90f_
    complexed with 3at, ca, yb

Details for d1k90c_

PDB Entry: 1k90 (more details), 2.75 Å

PDB Description: Crystal structure of the adenylyl cyclase domain of anthrax edema factor (EF) in complex with calmodulin and 3' deoxy-ATP
PDB Compounds: (C:) calmodulin-sensitive adenylate cyclase

SCOPe Domain Sequences for d1k90c_:

Sequence, based on SEQRES records: (download)

>d1k90c_ e.41.1.1 (C:) Adenylylcyclase toxin (the edema factor) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhi
fsqekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqksni
efkllykqlnftenetdnfevfqkiid

Sequence, based on observed residues (ATOM records): (download)

>d1k90c_ e.41.1.1 (C:) Adenylylcyclase toxin (the edema factor) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhi
fsqekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqkfkl
lykqlnftenetdnfevfqkiid

SCOPe Domain Coordinates for d1k90c_:

Click to download the PDB-style file with coordinates for d1k90c_.
(The format of our PDB-style files is described here.)

Timeline for d1k90c_: