Lineage for d1k90a_ (1k90 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2250180Fold e.41: Adenylylcyclase toxin (the edema factor) [81299] (1 superfamily)
    3 domains: (1&2) alpha+beta, with domain 2 being inserted in domain 1; (3) all-alpha
  4. 2250181Superfamily e.41.1: Adenylylcyclase toxin (the edema factor) [81298] (1 family) (S)
    Domain 1 has topological and active site similarity to the Nucleotidyltransferases (eg. 1kny N-domain); domain 3 binds calmodulin
  5. 2250182Family e.41.1.1: Adenylylcyclase toxin (the edema factor) [69887] (1 protein)
    decorated with many insertions and the C-terminal domain
  6. 2250183Protein Adenylylcyclase toxin (the edema factor) [69888] (1 species)
  7. 2250184Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69889] (7 PDB entries)
    Uniprot P40136
  8. 2250186Domain d1k90a_: 1k90 A: [68319]
    Other proteins in same PDB: d1k90d_, d1k90e_, d1k90f_
    complexed with 3at, ca, yb

Details for d1k90a_

PDB Entry: 1k90 (more details), 2.75 Å

PDB Description: Crystal structure of the adenylyl cyclase domain of anthrax edema factor (EF) in complex with calmodulin and 3' deoxy-ATP
PDB Compounds: (A:) calmodulin-sensitive adenylate cyclase

SCOPe Domain Sequences for d1k90a_:

Sequence, based on SEQRES records: (download)

>d1k90a_ e.41.1.1 (A:) Adenylylcyclase toxin (the edema factor) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhi
fsqekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqksni
efkllykqlnftenetdnfevfqkiid

Sequence, based on observed residues (ATOM records): (download)

>d1k90a_ e.41.1.1 (A:) Adenylylcyclase toxin (the edema factor) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrsssvkkiagylsdyynsanhifsqekkrkisifrgiqay
neienvlkskqiapeyknyfqylkeritnqvqlllthqkfkllykqlnftenetdnfevf
qkiid

SCOPe Domain Coordinates for d1k90a_:

Click to download the PDB-style file with coordinates for d1k90a_.
(The format of our PDB-style files is described here.)

Timeline for d1k90a_: