Lineage for d1k90a_ (1k90 A:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141159Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 141160Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 141296Family e.9.1.4: Adenylylcyclase toxin (the edema factor) [69887] (1 protein)
  6. 141297Protein Adenylylcyclase toxin (the edema factor) [69888] (1 species)
  7. 141298Species Bacillus anthracis [TaxId:1392] [69889] (3 PDB entries)
  8. 141300Domain d1k90a_: 1k90 A: [68319]
    Other proteins in same PDB: d1k90d_, d1k90e_, d1k90f_

Details for d1k90a_

PDB Entry: 1k90 (more details), 2.75 Å

PDB Description: Crystal structure of the adenylyl cyclase domain of anthrax edema factor (EF) in complex with calmodulin and 3' deoxy-ATP

SCOP Domain Sequences for d1k90a_:

Sequence, based on SEQRES records: (download)

>d1k90a_ e.9.1.4 (A:) Adenylylcyclase toxin (the edema factor) {Bacillus anthracis}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhi
fsqekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqksni
efkllykqlnftenetdnfevfqkiid

Sequence, based on observed residues (ATOM records): (download)

>d1k90a_ e.9.1.4 (A:) Adenylylcyclase toxin (the edema factor) {Bacillus anthracis}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrsssvkkiagylsdyynsanhifsqekkrkisifrgiqay
neienvlkskqiapeyknyfqylkeritnqvqlllthqkfkllykqlnftenetdnfevf
qkiid

SCOP Domain Coordinates for d1k90a_:

Click to download the PDB-style file with coordinates for d1k90a_.
(The format of our PDB-style files is described here.)

Timeline for d1k90a_: