Lineage for d1k8kg_ (1k8k G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922841Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
  5. 922842Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 922843Protein Arp2/3 complex 16 kDa subunit ARPC5 [69105] (1 species)
  7. 922844Species Cow (Bos taurus) [TaxId:9913] [69106] (3 PDB entries)
    Uniprot Q9CPW4 # 99% sequence identity
  8. 922845Domain d1k8kg_: 1k8k G: [68313]
    Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kf_

Details for d1k8kg_

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex
PDB Compounds: (G:) arp2/3 complex 16 kda subunit

SCOPe Domain Sequences for d1k8kg_:

Sequence, based on SEQRES records: (download)

>d1k8kg_ a.118.13.1 (G:) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d1k8kg_ a.118.13.1 (G:) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddgagpdegevdsclrqgnmtaalqaalknppintksqavk
dragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwheka
laaggvgsivrvltarktv

SCOPe Domain Coordinates for d1k8kg_:

Click to download the PDB-style file with coordinates for d1k8kg_.
(The format of our PDB-style files is described here.)

Timeline for d1k8kg_: