SCOPe 2.01: Domain d1k8ke_: 1k8k E:

Lineage for d1k8ke_ (1k8k E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
   5 helices; one helix is surrounded by the others

4. Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family)

5. Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)

6. Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [69063] (3 PDB entries)
   Uniprot O15145 # 100% sequence identity

8. Domain d1k8ke_: 1k8k E: [68311]
   Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8kf_, d1k8kg_

Details for d1k8ke_

PDB Entry: 1k8k, 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex

PDB Compounds: (E:) arp2/3 complex 21 kda subunit

SCOPe Domain Sequences for d1k8ke_:

Sequence; same for both SEQRES and ATOM records:

>d1k8ke_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg

Timeline for d1k8ke_:

• d1k8ke_ first appeared in SCOP 1.59
  
• d1k8ke_ appears in SCOP 1.75
  
• d1k8ke_ appears in SCOPe 2.02
  
• d1k8ke_ appears in the current release, SCOPe 2.08