Lineage for d1k8kd1 (1k8k D:1-120)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228690Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1228764Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1228765Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1228766Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 1228767Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 1228768Domain d1k8kd1: 1k8k D:1-120 [68309]
    Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8ke_, d1k8kf_, d1k8kg_

Details for d1k8kd1

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex
PDB Compounds: (D:) arp2/3 complex 34 kda subunit

SCOPe Domain Sequences for d1k8kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8kd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

SCOPe Domain Coordinates for d1k8kd1:

Click to download the PDB-style file with coordinates for d1k8kd1.
(The format of our PDB-style files is described here.)

Timeline for d1k8kd1: