SCOPe 2.01: Domain d1k8kb1: 1k8k B:154-343

Lineage for d1k8kb1 (1k8k B:154-343)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin-related protein 2, Arp2 [69530] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69531] (3 PDB entries)
   Uniprot P61160 143-350 # 100% sequence identity

8. Domain d1k8kb1: 1k8k B:154-343 [68307]
   Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kf_, d1k8kg_
   the second half only

Details for d1k8kb1

PDB Entry: 1k8k, 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex

PDB Compounds: (B:) actin-like protein 2

SCOPe Domain Sequences for d1k8kb1:

Sequence; same for both SEQRES and ATOM records:

>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv
rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv
egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd
veklskfkir

Timeline for d1k8kb1:

• d1k8kb1 first appeared in SCOP 1.59
  
• d1k8kb1 appears in SCOP 1.75
  
• d1k8kb1 appears in SCOPe 2.02
  
• d1k8kb1 appears in the current release, SCOPe 2.08