Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species) |
Species Mouse (Mus musculus), H2-DM [TaxId:10090] [69679] (1 PDB entry) |
Domain d1k8ib2: 1k8i B:1-94 [68304] Other proteins in same PDB: d1k8ia1, d1k8ib1 |
PDB Entry: 1k8i (more details), 3.1 Å
SCOP Domain Sequences for d1k8ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ib2 d.19.1.1 (B:1-94) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), H2-DM} gfvahvestcvlndagtpqdftycvsfnkdllacwdpdvgkivpcefgvlsrlaeiisni lneqeslihrlqnglqdcathtqpfwdvlthrtr
Timeline for d1k8ib2: