![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88627] (1 PDB entry) probably orthologous to the human HLA-DM |
![]() | Domain d1k8ib1: 1k8i B:95-190 [68303] Other proteins in same PDB: d1k8ia1, d1k8ia2, d1k8ib2 complexed with nag |
PDB Entry: 1k8i (more details), 3.1 Å
SCOP Domain Sequences for d1k8ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ib1 b.1.1.2 (B:95-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), H2-DM} apsvrvaqttpfntrepvmlacyvwgfypadvtitwmkngqlvpshsnkektaqpngdwt yqtvsylaltpsygdvytcvvqhsgtsepirgdwtp
Timeline for d1k8ib1: