SCOP 1.65: Domain d1k8ia1: 1k8i A:93-191

Lineage for d1k8ia1 (1k8i A:93-191)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88620] (1 PDB entry)
   probably orthologous to the human HLA-DM

8. Domain d1k8ia1: 1k8i A:93-191 [68301]
   Other proteins in same PDB: d1k8ia2, d1k8ib1, d1k8ib2
   complexed with nag

Details for d1k8ia1

PDB Entry: 1k8i, 3.1 Å

PDB Description: crystal structure of mouse h2-dm

SCOP Domain Sequences for d1k8ia1:

Sequence; same for both SEQRES and ATOM records:

>d1k8ia1 b.1.1.2 (A:93-191) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), H2-DM}
vsrglpvaevftlkplefgkpntlvcfisnlfpptltvnwqlhsapvegasptsisavdg
ltfqafsylnftpepfdlysctvtheidrytaiaywvpq

Timeline for d1k8ia1:

• d1k8ia1 first appeared in SCOP 1.59
  
• d1k8ia1 appears in SCOP 1.63
  
• d1k8ia1 appears in SCOP 1.67
  
• d1k8ia1 appears in the current release, SCOPe 2.08