Lineage for d1k8gc1 (1k8g C:36-204)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559752Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 559878Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 559879Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries)
  8. 559917Domain d1k8gc1: 1k8g C:36-204 [68299]

Details for d1k8gc1

PDB Entry: 1k8g (more details), 2.6 Å

PDB Description: Crystal Structure of the N-terminal domain of Oxytricha nova telomere end binding protein alpha subunit both uncomplexed and complexed with telomeric ssDNA

SCOP Domain Sequences for d1k8gc1:

Sequence, based on SEQRES records: (download)

>d1k8gc1 b.40.4.3 (C:36-204) Telomere end binding protein alpha subunit {Oxytricha nova}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

Sequence, based on observed residues (ATOM records): (download)

>d1k8gc1 b.40.4.3 (C:36-204) Telomere end binding protein alpha subunit {Oxytricha nova}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgasdya
tlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtq
einnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

SCOP Domain Coordinates for d1k8gc1:

Click to download the PDB-style file with coordinates for d1k8gc1.
(The format of our PDB-style files is described here.)

Timeline for d1k8gc1: