Lineage for d1k8gb1 (1k8g B:36-204)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799474Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 799623Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 799624Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)
  8. 799669Domain d1k8gb1: 1k8g B:36-204 [68297]
    two-domain fragment

Details for d1k8gb1

PDB Entry: 1k8g (more details), 2.6 Å

PDB Description: Crystal Structure of the N-terminal domain of Oxytricha nova telomere end binding protein alpha subunit both uncomplexed and complexed with telomeric ssDNA
PDB Compounds: (B:) Telomere-binding protein alpha subunit

SCOP Domain Sequences for d1k8gb1:

Sequence, based on SEQRES records: (download)

>d1k8gb1 b.40.4.3 (B:36-204) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

Sequence, based on observed residues (ATOM records): (download)

>d1k8gb1 b.40.4.3 (B:36-204) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqsdyatlv
lyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtqein
nqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

SCOP Domain Coordinates for d1k8gb1:

Click to download the PDB-style file with coordinates for d1k8gb1.
(The format of our PDB-style files is described here.)

Timeline for d1k8gb1: