Lineage for d1k8db_ (1k8d B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220722Species Mouse (Mus musculus), IB QA-2 [TaxId:10090] [69147] (1 PDB entry)
  8. 220724Domain d1k8db_: 1k8d B: [68294]
    Other proteins in same PDB: d1k8da2

Details for d1k8db_

PDB Entry: 1k8d (more details), 2.3 Å

PDB Description: crystal structure of the non-classical MHC class Ib Qa-2 complexed with a self peptide

SCOP Domain Sequences for d1k8db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8db_ b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), IB QA-2}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1k8db_:

Click to download the PDB-style file with coordinates for d1k8db_.
(The format of our PDB-style files is described here.)

Timeline for d1k8db_: