Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Mouse (Mus musculus), IB QA-2 [TaxId:10090] [69147] (1 PDB entry) |
Domain d1k8db1: 1k8d B: [68294] Other proteins in same PDB: d1k8da2 |
PDB Entry: 1k8d (more details), 2.3 Å
SCOP Domain Sequences for d1k8db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8db1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), IB QA-2} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1k8db1: