Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) |
Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) |
Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (26 PDB entries) Uniprot P20434; part of multichain biological unit |
Domain d1k83e1: 1k83 E:3-143 [68279] Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_ protein/DNA complex; protein/RNA complex; complexed with mn, zn |
PDB Entry: 1k83 (more details), 2.8 Å
SCOPe Domain Sequences for d1k83e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k83e1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqa npteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamk lvpsippatietfneaalvvn
Timeline for d1k83e1: