Lineage for d1k79a_ (1k79 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95355Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 95360Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 95364Species Mouse (Mus musculus) [TaxId:10090] [46863] (5 PDB entries)
  8. 95367Domain d1k79a_: 1k79 A: [68262]

Details for d1k79a_

PDB Entry: 1k79 (more details), 2.4 Å

PDB Description: Ets-1(331-440)+GGAA duplex

SCOP Domain Sequences for d1k79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k79a_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

SCOP Domain Coordinates for d1k79a_:

Click to download the PDB-style file with coordinates for d1k79a_.
(The format of our PDB-style files is described here.)

Timeline for d1k79a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k79d_