Class a: All alpha proteins [46456] (226 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (13 families) consists only of helices |
Family a.4.1.5: Paired domain [46748] (3 proteins) duplication: consists of two domains of this fold |
Protein Pax-5 [68962] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [68963] (2 PDB entries) |
Domain d1k78e2: 1k78 E:82-142 [68259] Other proteins in same PDB: d1k78b_, d1k78f_ |
PDB Entry: 1k78 (more details), 2.25 Å
SCOP Domain Sequences for d1k78e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k78e2 a.4.1.5 (E:82-142) Pax-5 {Human (Homo sapiens)} viggskpkvatpkvvekiaeykrqnptmfaweirdrllaervcdndtvpsvssinriirt k
Timeline for d1k78e2: