Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.21: ets domain [46859] (9 proteins) |
Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries) Uniprot P27577 301-440 |
Domain d1k78b_: 1k78 B: [68257] Other proteins in same PDB: d1k78a1, d1k78a2, d1k78e1, d1k78e2, d1k78i1 protein/DNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1k78 (more details), 2.25 Å
SCOPe Domain Sequences for d1k78b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k78b_ a.4.5.21 (B:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus) [TaxId: 10090]} iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk
Timeline for d1k78b_: