Lineage for d1k78a1 (1k78 A:19-81)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 149793Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 149961Family a.4.1.5: Paired domain [46748] (3 proteins)
  6. 149965Protein Pax-5 [68962] (1 species)
  7. 149966Species Human (Homo sapiens) [TaxId:9606] [68963] (1 PDB entry)
  8. 149967Domain d1k78a1: 1k78 A:19-81 [68255]
    Other proteins in same PDB: d1k78b_, d1k78f_

Details for d1k78a1

PDB Entry: 1k78 (more details), 2.25 Å

PDB Description: Pax5(1-149)+Ets-1(331-440)+DNA

SCOP Domain Sequences for d1k78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens)}
gvnqlggvfvngrplpdvvrqrivelahqgvrpcdisrqlrvshgcvskilgryyetgsi
kpg

SCOP Domain Coordinates for d1k78a1:

Click to download the PDB-style file with coordinates for d1k78a1.
(The format of our PDB-style files is described here.)

Timeline for d1k78a1:

149967
d1k78a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1k78a2