Lineage for d1k74a_ (1k74 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217562Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 217563Species Human (Homo sapiens) [TaxId:9606] [48511] (10 PDB entries)
  8. 217579Domain d1k74a_: 1k74 A: [68251]
    Other proteins in same PDB: d1k74d_
    heterodimer with PPAR-gamma complexed with co-activator peptides
    complexed with 544, rea

Details for d1k74a_

PDB Entry: 1k74 (more details), 2.3 Å

PDB Description: The 2.3 Angstrom resolution crystal structure of the heterodimer of the human PPARgamma and RXRalpha ligand binding domains respectively bound with GW409544 and 9-cis retinoic acid and co-activator peptides.

SCOP Domain Sequences for d1k74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k74a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens)}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOP Domain Coordinates for d1k74a_:

Click to download the PDB-style file with coordinates for d1k74a_.
(The format of our PDB-style files is described here.)

Timeline for d1k74a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k74d_