SCOPe 2.06: Domain d1k6za1: 1k6z A:1003-1130

Lineage for d1k6za1 (1k6z A:1003-1130)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
   the family sequences are very divergent

6. Protein YopE chaperone SycE [69637] (2 species)

7. Species Yersinia pestis [TaxId:632] [69638] (3 PDB entries)

8. Domain d1k6za1: 1k6z A:1003-1130 [68247]
   Other proteins in same PDB: d1k6za2, d1k6zb2
   complexed with imd

Details for d1k6za1

PDB Entry: 1k6z, 2 Å

PDB Description: crystal structure of the yersinia secretion chaperone syce

PDB Compounds: (A:) Type III secretion chaperone SycE

SCOPe Domain Sequences for d1k6za1:

Sequence, based on SEQRES records:

>d1k6za1 d.198.1.1 (A:1003-1130) YopE chaperone SycE {Yersinia pestis [TaxId: 632]}
sfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnndeket
llshnifsqdilkpilswdevgghpvlwnrqplnsldnnslytqlemlvqgaerlqtssl
ispprsfs

Sequence, based on observed residues (ATOM records):

>d1k6za1 d.198.1.1 (A:1003-1130) YopE chaperone SycE {Yersinia pestis [TaxId: 632]}
sfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnndeket
llshnifsqdilkpilswdevgghpvlwnrqplnsldnnslytqlemlvqgaerlqrsfs

Timeline for d1k6za1:

• d1k6za1 first appeared in SCOP 1.59, called d1k6za_
  
• d1k6za1 was called d1k6za_ in SCOPe 2.05
  
• d1k6za1 appears in SCOPe 2.07
  
• d1k6za1 appears in the current release, SCOPe 2.08