SCOP 1.75: Domain d1k6wa1: 1k6w A:4-55,A:376-426

Lineage for d1k6wa1 (1k6w A:4-55,A:376-426)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.2: Cytosine deaminase [69373] (1 protein)

6. Protein Cytosine deaminase [69374] (1 species)

7. Species Escherichia coli [TaxId:562] [69375] (8 PDB entries)
   Uniprot P25524

8. Domain d1k6wa1: 1k6w A:4-55,A:376-426 [68236]
   Other proteins in same PDB: d1k6wa2
   complexed with fe

Details for d1k6wa1

PDB Entry: 1k6w, 1.75 Å

PDB Description: The Structure of Escherichia coli Cytosine Deaminase

PDB Compounds: (A:) Cytosine deaminase

SCOP Domain Sequences for d1k6wa1:

Sequence; same for both SEQRES and ATOM records:

>d1k6wa1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli [TaxId: 562]}
alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipXliilpae
ngfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr

Timeline for d1k6wa1:

• d1k6wa1 first appeared in SCOP 1.59
  
• d1k6wa1 appears in SCOP 1.73
  
• d1k6wa1 appears in SCOPe 2.01
  
• d1k6wa1 appears in the current release, SCOPe 2.08