Lineage for d1k6ta_ (1k6t A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 112553Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 112554Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 112555Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 112853Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 112854Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)
  8. 112862Domain d1k6ta_: 1k6t A: [68231]

Details for d1k6ta_

PDB Entry: 1k6t (more details), 2.25 Å

PDB Description: lack of synergy for inhibitors targeting a multi-drug resistant hiv-1 protease

SCOP Domain Sequences for d1k6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6ta_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOP Domain Coordinates for d1k6ta_:

Click to download the PDB-style file with coordinates for d1k6ta_.
(The format of our PDB-style files is described here.)

Timeline for d1k6ta_: