Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species) |
Species Escherichia coli [TaxId:562] [69771] (11 PDB entries) Uniprot P45568 |
Domain d1k5hc3: 1k5h C:126-274 [68200] Other proteins in same PDB: d1k5ha1, d1k5ha2, d1k5hb1, d1k5hb2, d1k5hc1, d1k5hc2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1k5h (more details), 2.5 Å
SCOPe Domain Sequences for d1k5hc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5hc3 d.81.1.3 (C:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq mevlihpqsvihsmvryqdgsvlaqlgep
Timeline for d1k5hc3: