Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.3: Ran-binding domain [50764] (5 proteins) |
Protein Ran-binding protein 1, Ranbp1 [69292] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69293] (2 PDB entries) |
Domain d1k5dh_: 1k5d H: [68175] Other proteins in same PDB: d1k5da_, d1k5dc_, d1k5dd_, d1k5df_, d1k5dg_, d1k5di_, d1k5dj_, d1k5dl_ complexed with gnp, mg |
PDB Entry: 1k5d (more details), 2.7 Å
SCOPe Domain Sequences for d1k5dh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5dh_ b.55.1.3 (H:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]} nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair flnaenaqkfktkfeecrkeieerek
Timeline for d1k5dh_: