SCOP 1.65: Domain d1k53a_: 1k53 A:

Lineage for d1k53a_ (1k53 A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)

8. Domain d1k53a_: 1k53 A: [68150]

Details for d1k53a_

PDB Entry: 1k53, 2.1 Å

PDB Description: monomeric protein l b1 domain with a g15a mutation

SCOP Domain Sequences for d1k53a_:

Sequence; same for both SEQRES and ATOM records:

>d1k53a_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
mhhhhhhameevtikanlifanastqtaefkgtfekatseayayadtlkkdngewtvdva
dkgytlnikfag

Timeline for d1k53a_:

• d1k53a_ first appeared in SCOP 1.59
  
• d1k53a_ appears in SCOP 1.63
  
• d1k53a_ appears in SCOP 1.67
  
• d1k53a_ appears in the current release, SCOPe 2.08, called d1k53a1