SCOPe 2.04: Domain d1k4dc_: 1k4d C:

Lineage for d1k4dc_ (1k4d C:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (17 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d1k4dc_: 1k4d C: [68135]
   Other proteins in same PDB: d1k4da1, d1k4da2, d1k4db1, d1k4db2
   residues 22-124
   complexed with dga, f09, k, na

Details for d1k4dc_

PDB Entry: 1k4d, 2.3 Å

PDB Description: potassium channel kcsa-fab complex in low concentration of k+

PDB Compounds: (C:) potassium channel kcsa

SCOPe Domain Sequences for d1k4dc_:

Sequence; same for both SEQRES and ATOM records:

>d1k4dc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d1k4dc_:

• d1k4dc_ first appeared in SCOP 1.59
  
• d1k4dc_ appears in SCOPe 2.03
  
• d1k4dc_ appears in SCOPe 2.05
  
• d1k4dc_ appears in the current release, SCOPe 2.08