Lineage for d1k4dc_ (1k4d C:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267828Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 267829Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 267830Family f.14.1.1: Voltage-gated potassium channels [81323] (2 proteins)
  6. 267831Protein Potassium channel protein [56901] (1 species)
  7. 267832Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)
  8. 267834Domain d1k4dc_: 1k4d C: [68135]
    Other proteins in same PDB: d1k4da1, d1k4da2, d1k4db1, d1k4db2
    residues 22-124
    complexed with dga, f09, k, na; mutant

Details for d1k4dc_

PDB Entry: 1k4d (more details), 2.3 Å

PDB Description: Potassium Channel KcsA-Fab complex in low concentration of K+

SCOP Domain Sequences for d1k4dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4dc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOP Domain Coordinates for d1k4dc_:

Click to download the PDB-style file with coordinates for d1k4dc_.
(The format of our PDB-style files is described here.)

Timeline for d1k4dc_: