SCOP 1.59: Domain d1k4dc_: 1k4d C:

Lineage for d1k4dc_ (1k4d C:)

1. Root: SCOP 1.59

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (11 families)

5. Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins)

6. Protein Potassium chanel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)

8. Domain d1k4dc_: 1k4d C: [68135]
   Other proteins in same PDB: d1k4da1, d1k4da2, d1k4db1, d1k4db2

Details for d1k4dc_

PDB Entry: 1k4d, 2.3 Å

PDB Description: potassium channel kcsa-fab complex in low concentration of k+

SCOP Domain Sequences for d1k4dc_:

Sequence; same for both SEQRES and ATOM records:

>d1k4dc_ f.2.1.11 (C:) Potassium chanel protein {Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d1k4dc_:

• d1k4dc_ is new in SCOP 1.59
  
• d1k4dc_ appears in SCOP 1.61
  
• d1k4dc_ appears in the current release, SCOPe 2.08