Lineage for d1k4db2 (1k4d B:108-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104065Species Fab against potassium channel KcsA, (mouse), kappa L chain [69151] (2 PDB entries)
  8. 104069Domain d1k4db2: 1k4d B:108-212 [68134]
    Other proteins in same PDB: d1k4da1, d1k4db1, d1k4dc_

Details for d1k4db2

PDB Entry: 1k4d (more details), 2.3 Å

PDB Description: Potassium Channel KcsA-Fab complex in low concentration of K+

SCOP Domain Sequences for d1k4db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4db2 b.1.1.2 (B:108-212) Immunoglobulin (constant domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1k4db2:

Click to download the PDB-style file with coordinates for d1k4db2.
(The format of our PDB-style files is described here.)

Timeline for d1k4db2: