Lineage for d1k4db1 (1k4d B:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363836Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)
  8. 363913Domain d1k4db1: 1k4d B:1-107 [68133]
    Other proteins in same PDB: d1k4da1, d1k4da2, d1k4db2, d1k4dc_
    part of Fab against potassium channel KcsA
    complexed with dga, f09, k, na; mutant

Details for d1k4db1

PDB Entry: 1k4d (more details), 2.3 Å

PDB Description: Potassium Channel KcsA-Fab complex in low concentration of K+

SCOP Domain Sequences for d1k4db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4db1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

SCOP Domain Coordinates for d1k4db1:

Click to download the PDB-style file with coordinates for d1k4db1.
(The format of our PDB-style files is described here.)

Timeline for d1k4db1: