Lineage for d1k4db1 (1k4d B:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219560Species Fab against potassium channel KcsA, (mouse), kappa L chain [69140] (2 PDB entries)
  8. 219564Domain d1k4db1: 1k4d B:1-107 [68133]
    Other proteins in same PDB: d1k4da2, d1k4db2, d1k4dc_
    complexed with dga, f09, k, na; mutant

Details for d1k4db1

PDB Entry: 1k4d (more details), 2.3 Å

PDB Description: Potassium Channel KcsA-Fab complex in low concentration of K+

SCOP Domain Sequences for d1k4db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4db1 b.1.1.1 (B:1-107) Immunoglobulin (variable domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

SCOP Domain Coordinates for d1k4db1:

Click to download the PDB-style file with coordinates for d1k4db1.
(The format of our PDB-style files is described here.)

Timeline for d1k4db1: