Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
Domain d1k4da2: 1k4d A:119-219 [68132] Other proteins in same PDB: d1k4da1, d1k4db1, d1k4db2, d1k4dc_ part of Fab against potassium channel KcsA complexed with dga, f09, k, na; mutant |
PDB Entry: 1k4d (more details), 2.3 Å
SCOP Domain Sequences for d1k4da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4da2 b.1.1.2 (A:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
Timeline for d1k4da2: