Lineage for d1k4da2 (1k4d A:119-219)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221362Species Fab against potassium channel KcsA, (mouse), kappa L chain [69151] (2 PDB entries)
  8. 221365Domain d1k4da2: 1k4d A:119-219 [68132]
    Other proteins in same PDB: d1k4da1, d1k4db1, d1k4dc_

Details for d1k4da2

PDB Entry: 1k4d (more details), 2.3 Å

PDB Description: Potassium Channel KcsA-Fab complex in low concentration of K+

SCOP Domain Sequences for d1k4da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4da2 b.1.1.2 (A:119-219) Immunoglobulin (constant domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1k4da2:

Click to download the PDB-style file with coordinates for d1k4da2.
(The format of our PDB-style files is described here.)

Timeline for d1k4da2: